Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9) is a purified Recombinant Protein; Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV) . Target Name: Nsp9. Target Synonyms: Non-structural protein 9. Accession Number: P0DTD1/YP_009742616.1. Expression Region: 1~113aa. Tag Info: C-Terminal Hfc-Flag-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9) is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

P0DTD1/YP_009742616.1

Expression Region

1~113aa

Host

Mammalian Cells

Target

Nsp9

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Flag-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Non-structural protein 9

Species

Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF606 Protein Vector (Human) (pPB-N-His)
PV048098 500 ng

ZNF606 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse total Tau Proteins (ttau) ELISA Kit
MBS1601148-01 48 Well

Mouse total Tau Proteins (ttau) ELISA Kit

Sign In for Pricing
View Details
Mouse total Tau Proteins (ttau) ELISA Kit
MBS1601148-02 96 Well

Mouse total Tau Proteins (ttau) ELISA Kit

Sign In for Pricing
View Details
Mouse total Tau Proteins (ttau) ELISA Kit
MBS1601148-03 5x 96 Well

Mouse total Tau Proteins (ttau) ELISA Kit

Sign In for Pricing
View Details
Mouse total Tau Proteins (ttau) ELISA Kit
MBS1601148-04 10x 96 Well

Mouse total Tau Proteins (ttau) ELISA Kit

Sign In for Pricing
View Details
PTPRO siRNA (Human)
MBS8204331-01 15 nmol

PTPRO siRNA (Human)

Sign In for Pricing
View Details