Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Basigin (BSG), partial

Recombinant Human Basigin (BSG), partial is a purified Recombinant Protein; Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: BSG/ CD147. Target Synonyms: 5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group) ; Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6. Accession Number: P35613. Expression Region: 138~323aa. Tag Info: C-Terminal 6Xhis-Myc-Tagged. Theoretical MW: 24.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Basigin (BSG), partial is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

P35613

Expression Region

138~323aa

Host

Mammalian Cells

Target

BSG/ CD147

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

5A11 antigen; 5F7; BASI_HUMAN; Basigin (Ok blood group) ; Basigin; Blood brain barrier HT7 antigen; Bsg; CD 147; CD147; CD147 antigen; Collagenase stimulatory factor; EMMPRIN; Extracellular matrix metalloproteinase inducer; Leukocyte activation antigen M6; M 6; M6; M6 leukocyte activation antigen; Neurothelin; OK; OK blood group; OK blood group antigen; TCSF; Tumor cell derived collagenase stimulatory factor; Tumor cell-derived collagenase stimulatory factor

Species

Human (Homo sapiens)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf58 Lentiviral Activation Particles (h)
sc-408447-LAC 200 µL

C3orf58 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Mouse AMIGO3 (NP_796249) VersaClone cDNA
RDC1925 10 µg

Mouse AMIGO3 (NP_796249) VersaClone cDNA

Sign In for Pricing
View Details
KRT2 ORF Vector (Human) (pORF)
26005011 1.0 µg DNA

KRT2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Staphylococcus aureus (AP)
MBS6248313-01 0.1 mL

Staphylococcus aureus (AP)

Sign In for Pricing
View Details
Staphylococcus aureus (AP)
MBS6248313-02 5x 0.1 mL

Staphylococcus aureus (AP)

Sign In for Pricing
View Details
Hid1 Mouse shRNA Lentiviral Particle (Locus ID 217310)
TL512064V 500 µL Each

Hid1 Mouse shRNA Lentiviral Particle (Locus ID 217310)

Sign In for Pricing
View Details