Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5)

Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Gphb5. Target Synonyms: Thyrostimulin subunit beta. Accession Number: Q812B2. Expression Region: 25~130aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 13.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5) is a purified Recombinant Protein.

Accession Number

Q812B2

Expression Region

25~130aa

Host

Yeast

Target

Gphb5

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Thyrostimulin subunit beta

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH-PTP2 Polyclonal Antibody
JOT-AP08301-01 20 µL

SH-PTP2 Polyclonal Antibody

Sign In for Pricing
View Details
SH-PTP2 Polyclonal Antibody
JOT-AP08301-02 50 μL

SH-PTP2 Polyclonal Antibody

Sign In for Pricing
View Details
SH-PTP2 Polyclonal Antibody
JOT-AP08301-03 100 µL

SH-PTP2 Polyclonal Antibody

Sign In for Pricing
View Details
SH2B adapter protein 2 (SH2B2) Mouse ELISA Kit
H0208 96 Tests

SH2B adapter protein 2 (SH2B2) Mouse ELISA Kit

Sign In for Pricing
View Details
Never In Mitosis Gene A Related Kinase 2 (NEK2) Recombinant, Mouse
156095-01 10 µg

Never In Mitosis Gene A Related Kinase 2 (NEK2) Recombinant, Mouse

Sign In for Pricing
View Details
Never In Mitosis Gene A Related Kinase 2 (NEK2) Recombinant, Mouse
156095-02 50 µg

Never In Mitosis Gene A Related Kinase 2 (NEK2) Recombinant, Mouse

Sign In for Pricing
View Details