Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor for retinol uptake STRA6 (STRA6), partial

Recombinant Human Receptor for retinol uptake STRA6 (STRA6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: STRA6. Target Synonyms: Retinol-binding protein receptor STRA6; Stimulated by retinoic acid gene 6 protein homolog. Accession Number: Q9BX79. Expression Region: 1~50aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 34.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Receptor for retinol uptake STRA6 (STRA6), partial is a purified Recombinant Protein.

Accession Number

Q9BX79

Expression Region

1~50aa

Host

Mammalian Cells

Target

STRA6

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Retinol-binding protein receptor STRA6; Stimulated by retinoic acid gene 6 protein homolog

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL2 siRNA (Human)
MBS829129-01 15 nmol

CXCL2 siRNA (Human)

Sign In for Pricing
View Details
CXCL2 siRNA (Human)
MBS829129-02 30 nmol

CXCL2 siRNA (Human)

Sign In for Pricing
View Details
CXCL2 siRNA (Human)
MBS829129-03 5x 30 nmol

CXCL2 siRNA (Human)

Sign In for Pricing
View Details
ZIC1, NT (ZIC1, ZIC, ZNF201, Zinc finger protein ZIC 1, Zinc finger protein 201, Zinc finger protein of the cerebellum 1) (APC) discontinued
044085-APC 200 µL

ZIC1, NT (ZIC1, ZIC, ZNF201, Zinc finger protein ZIC 1, Zinc finger protein 201, Zinc finger protein of the cerebellum 1) (APC) discontinued

Sign In for Pricing
View Details
DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (Azide free) (HRP)
MBS6472938-01 0.2 mL

DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (Azide free) (HRP)

Sign In for Pricing
View Details
DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (Azide free) (HRP)
MBS6472938-02 5x 0.2 mL

DCX (S128) (Neuronal Migration Protein Doublecortin, Lissencephalin-X, Lis-X, Doublin, DBCN, LISX) (Azide free) (HRP)

Sign In for Pricing
View Details