Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein FAM3B (Fam3b)

Recombinant Mouse Protein FAM3B (Fam3b) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Fam3b. Target Synonyms: Cytokine-like protein 2-21Pancreatic-derived factorPANDER. Accession Number: Q9D309. Expression Region: 30~235aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 51.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Protein FAM3B (Fam3b) is a purified Recombinant Protein.

Accession Number

Q9D309

Expression Region

30~235aa

Host

Mammalian Cells

Target

Fam3b

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Tagged

Field of Research

Cytokine

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

51.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytokine-like protein 2-21Pancreatic-derived factorPANDER

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAF2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
50583154 3x 1.0 µg DNA

YAF2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)
MBS2091215-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)
MBS2091215-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)
MBS2091215-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)
MBS2091215-04 1 mL

Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)
MBS2091215-05 5 mL

Biotin-Linked Monoclonal Antibody to Alpha-1-B-Glycoprotein (a1BG)

Sign In for Pricing
View Details