Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Nucleoprotein (N)

Recombinant Human coronavirus 229E Nucleoprotein (N) is a purified Recombinant Protein; Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human coronavirus 229E (HCoV-229E) . Target Name: N. Target Synonyms: Nucleocapsid protein; NC; Protein N. Accession Number: P15130. Expression Region: 1~389aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 45.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human coronavirus 229E Nucleoprotein (N) is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

P15130

Expression Region

1~389aa

Host

Mammalian Cells

Target

N

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

45.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nucleocapsid protein; NC; Protein N

Species

Human coronavirus 229E (HCoV-229E)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F Transcription Factor 7 (E2F7) Antibody
abx028604-01 80 µL

E2F Transcription Factor 7 (E2F7) Antibody

Sign In for Pricing
View Details
E2F Transcription Factor 7 (E2F7) Antibody
abx028604-02 400 µL

E2F Transcription Factor 7 (E2F7) Antibody

Sign In for Pricing
View Details
Recombinant Human Transcription factor Sp4 (SP4)
orb3011267-01 20 µg

Recombinant Human Transcription factor Sp4 (SP4)

Sign In for Pricing
View Details
Recombinant Human Transcription factor Sp4 (SP4)
orb3011267-02 100 µg

Recombinant Human Transcription factor Sp4 (SP4)

Sign In for Pricing
View Details
Recombinant Human Transcription factor Sp4 (SP4)
orb3011267-03 1 mg

Recombinant Human Transcription factor Sp4 (SP4)

Sign In for Pricing
View Details
Polyclonal Dcaf11 antibody - C-terminal region
APR15691G 0.05mg

Polyclonal Dcaf11 antibody - C-terminal region

Sign In for Pricing
View Details