Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HTR1D. Target Synonyms: 5-HT-1D; 5-HT1D; Serotonin 1D alpha receptor; 5-HT-1D-alpha; Serotonin receptor 1D. Accession Number: P28221. Expression Region: 1~38aa. Tag Info: C-Terminal Hfc-Tagged. Theoretical MW: 33.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial is a purified Recombinant Protein.

Accession Number

P28221

Expression Region

1~38aa

Host

Mammalian Cells

Target

HTR1D

Conjugation

Unconjugated

Tag

C-Terminal Hfc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

5-HT-1D; 5-HT1D; Serotonin 1D alpha receptor; 5-HT-1D-alpha; Serotonin receptor 1D

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse ACHE Polyclonal Antibody
MB787014-01 50 µg

Anti-Mouse ACHE Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse ACHE Polyclonal Antibody
MB787014-02 100 µg

Anti-Mouse ACHE Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Interleukin 12 Receptor Beta 2 (IL12Rb2) Protein
abx067437-01 10 µg

Mouse Interleukin 12 Receptor Beta 2 (IL12Rb2) Protein

Sign In for Pricing
View Details
Mouse Interleukin 12 Receptor Beta 2 (IL12Rb2) Protein
abx067437-02 50 µg

Mouse Interleukin 12 Receptor Beta 2 (IL12Rb2) Protein

Sign In for Pricing
View Details
Mouse Interleukin 12 Receptor Beta 2 (IL12Rb2) Protein
abx067437-03 100 µg

Mouse Interleukin 12 Receptor Beta 2 (IL12Rb2) Protein

Sign In for Pricing
View Details
Mouse Interleukin 12 Receptor Beta 2 (IL12Rb2) Protein
abx067437-04 200 µg

Mouse Interleukin 12 Receptor Beta 2 (IL12Rb2) Protein

Sign In for Pricing
View Details