Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1)

Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Prkab1. Target Synonyms: AMPK subunit beta-1 (AMPKb) . Accession Number: Q9R078. Expression Region: 2~270aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse 5-AMP-activated protein kinase subunit beta-1 (Prkab1) is a purified Recombinant Protein.

Accession Number

Q9R078

Expression Region

2~270aa

Host

E. coli

Target

Prkab1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AMPK subunit beta-1 (AMPKb)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Coatomer subunit beta'-1 (At1g79990) , partial
MBS1430742 Inquire

Recombinant Arabidopsis thaliana Coatomer subunit beta'-1 (At1g79990) , partial

Sign In for Pricing
View Details
Tsga13 ORF Vector (Rat) (pORF)
ORF078323 1.0 µg DNA

Tsga13 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
NUP107 Antibody, FITC conjugated
A30168-100UG 100 µg

NUP107 Antibody, FITC conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD20 Antibody (B9E9)
NBP2-32927-0.1mg 0.1 mg

Mouse Monoclonal CD20 Antibody (B9E9)

Sign In for Pricing
View Details
Rabbit Polyclonal LCAT Antibody [Alexa Fluor 350]
NBP3-00108AF350 0.1 mL

Rabbit Polyclonal LCAT Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Porcine Renin, REN ELISA KIT
E0493Po-01 48 Well

Porcine Renin, REN ELISA KIT

Sign In for Pricing
View Details