Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Non-structural glycoprotein 4

Recombinant Rotavirus A Non-structural glycoprotein 4 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) . Target Name: Rotavirus A Non-structural glycoprotein 4. Target Synonyms: NCVP5 (NS28; NSP4) . Accession Number: Q9PYC8. Expression Region: 52~175aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 30.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rotavirus A Non-structural glycoprotein 4 is a purified Recombinant Protein.

Accession Number

Q9PYC8

Expression Region

52~175aa

Host

E. coli

Target

Rotavirus A Non-structural glycoprotein 4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

NCVP5 (NS28; NSP4)

Species

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Protein Name

Recombinant Protein

AA Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Frataxin Antibody (rFXN/2124) [PerCP]
NBP3-08576PCP 0.1 mL

Mouse Monoclonal Frataxin Antibody (rFXN/2124) [PerCP]

Sign In for Pricing
View Details
LAMB2 Antibody
orb683827 100 µL

LAMB2 Antibody

Sign In for Pricing
View Details
Human MAGEA12 (NM_005367) AAV Particle
RC201480A1V 250 µL

Human MAGEA12 (NM_005367) AAV Particle

Sign In for Pricing
View Details
CCKBR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV657482 1.0 µg DNA

CCKBR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PAX9 (Paired Box Protein Pax-9)
130913 100 µg

PAX9 (Paired Box Protein Pax-9)

Sign In for Pricing
View Details
Human S100A11 ELISA Kit (Ready to Use)
orb552266-01 48 Tests

Human S100A11 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details