Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pisum sativum Leghemoglobin Lb120-8

Recombinant Pisum sativum Leghemoglobin Lb120-8 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pisum sativum (Garden pea) . Target Name: Pisum sativum Leghemoglobin Lb120-8. Accession Number: Q9SAZ1. Expression Region: 2~146aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Pisum sativum Leghemoglobin Lb120-8 is a purified Recombinant Protein.

Accession Number

Q9SAZ1

Expression Region

2~146aa

Host

E. coli

Target

Pisum sativum Leghemoglobin Lb120-8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Pisum sativum (Garden pea)

Protein Name

Recombinant Protein

AA Sequence

GFTEKQEALVNSSWELFKQNPSYSVLFYTIILKKAPAAKGMFSFLKDSAEVVDSPKLQAHAEKVFGMVHDSAIQLRASGEVVLGDVTLGAIHIQKGVIDPHFVVVKEALLDTIKEASGEKWSEELSTAWEIAYEGLASAIKKAMN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nucleolar GTP-binding protein 1, Gtpbp4 ELISA KIT
ELI-07337m 96 Tests

Mouse Nucleolar GTP-binding protein 1, Gtpbp4 ELISA KIT

Sign In for Pricing
View Details
Mouse Monoclonal Plakophilin 4 Antibody (4H7)
H00008502-M06 0.1 mg

Mouse Monoclonal Plakophilin 4 Antibody (4H7)

Sign In for Pricing
View Details
NK 611
MF-0048274-01 100 mg

NK 611

Sign In for Pricing
View Details
NK 611
MF-0048274-02 25 mg

NK 611

Sign In for Pricing
View Details
NK 611
MF-0048274-03 50 mg

NK 611

Sign In for Pricing
View Details
Mouse Destrin (DSTN) ELISA Kit
MBS7238288-01 48 Well

Mouse Destrin (DSTN) ELISA Kit

Sign In for Pricing
View Details