Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pisum sativum Leghemoglobin Lb120-8

Recombinant Pisum sativum Leghemoglobin Lb120-8 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pisum sativum (Garden pea) . Target Name: Pisum sativum Leghemoglobin Lb120-8. Accession Number: Q9SAZ1. Expression Region: 2~146aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Pisum sativum Leghemoglobin Lb120-8 is a purified Recombinant Protein.

Accession Number

Q9SAZ1

Expression Region

2~146aa

Host

E. coli

Target

Pisum sativum Leghemoglobin Lb120-8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Pisum sativum (Garden pea)

Protein Name

Recombinant Protein

AA Sequence

GFTEKQEALVNSSWELFKQNPSYSVLFYTIILKKAPAAKGMFSFLKDSAEVVDSPKLQAHAEKVFGMVHDSAIQLRASGEVVLGDVTLGAIHIQKGVIDPHFVVVKEALLDTIKEASGEKWSEELSTAWEIAYEGLASAIKKAMN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Tollip Antibody (SB40a) [Janelia Fluor 585]
NBP1-28621JF585 0.1 mL

Mouse Monoclonal Tollip Antibody (SB40a) [Janelia Fluor 585]

Sign In for Pricing
View Details
Lentiviral human ERBB4 shRNA (UAS) - Lentiviral human ERBB4 shRNA (UAS, GFP) (100)
GTR15114069 1 Vial

Lentiviral human ERBB4 shRNA (UAS) - Lentiviral human ERBB4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal ENPP4 Antibody
NBP3-05178-20ul 20 µL

Rabbit Polyclonal ENPP4 Antibody

Sign In for Pricing
View Details
Canine parvovirus
CPV/9C4 1 mL

Canine parvovirus

Sign In for Pricing
View Details
Rabbit Polyclonal EDA-A1/Ectodysplasin A1 Antibody
NBP2-81908 0.1 mg

Rabbit Polyclonal EDA-A1/Ectodysplasin A1 Antibody

Sign In for Pricing
View Details
Hsa-miR-6499-5p miRNA Agomir
CMJ1979-01 5 nmol

Hsa-miR-6499-5p miRNA Agomir

Sign In for Pricing
View Details