Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pisum sativum Leghemoglobin Lb120-8

Recombinant Pisum sativum Leghemoglobin Lb120-8 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pisum sativum (Garden pea) . Target Name: Pisum sativum Leghemoglobin Lb120-8. Accession Number: Q9SAZ1. Expression Region: 2~146aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Pisum sativum Leghemoglobin Lb120-8 is a purified Recombinant Protein.

Accession Number

Q9SAZ1

Expression Region

2~146aa

Host

E. coli

Target

Pisum sativum Leghemoglobin Lb120-8

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Pisum sativum (Garden pea)

Protein Name

Recombinant Protein

AA Sequence

GFTEKQEALVNSSWELFKQNPSYSVLFYTIILKKAPAAKGMFSFLKDSAEVVDSPKLQAHAEKVFGMVHDSAIQLRASGEVVLGDVTLGAIHIQKGVIDPHFVVVKEALLDTIKEASGEKWSEELSTAWEIAYEGLASAIKKAMN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dyrk1a (NM_007890) Mouse Tagged ORF Clone Lentiviral Particle
MR221655L4V 200 µL

Dyrk1a (NM_007890) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TCF7 (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1, MGC129647, MGC129648) (MaxLight 550)
MBS6396221-01 0.1 mL

TCF7 (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1, MGC129647, MGC129648) (MaxLight 550)

Sign In for Pricing
View Details
TCF7 (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1, MGC129647, MGC129648) (MaxLight 550)
MBS6396221-02 5x 0.1 mL

TCF7 (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1, MGC129647, MGC129648) (MaxLight 550)

Sign In for Pricing
View Details
TOLL-LIKE RECEPTOR 3 (TLR3. CD283), Antibody
GWB-2F1A3D 0.1 mg

TOLL-LIKE RECEPTOR 3 (TLR3. CD283), Antibody

Sign In for Pricing
View Details
Recombinant Murine Neuropoietin
P6180-100μg 100 µg

Recombinant Murine Neuropoietin

Sign In for Pricing
View Details
SPINT2 Polyclonal Antibody
E55A00206 100 µg

SPINT2 Polyclonal Antibody

Sign In for Pricing
View Details