Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta-specific protein 1 (PLAC1)

Recombinant Human Placenta-specific protein 1 (PLAC1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PLAC1. Accession Number: Q9HBJ0. Expression Region: 23~212aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Placenta-specific protein 1 (PLAC1) is a purified Recombinant Protein.

Accession Number

Q9HBJ0

Expression Region

23~212aa

Host

E. coli

Target

PLAC1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endophilin II HDR Plasmid (m)
sc-422915-HDR 20 µg

Endophilin II HDR Plasmid (m)

Sign In for Pricing
View Details
LldD Antibody
orb862138 2 mg

LldD Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae RFC4 Protein (aa 1-323) [His]
VAng-Wyb5454-1mg 1 mg

Recombinant Saccharomyces Cerevisiae RFC4 Protein (aa 1-323) [His]

Sign In for Pricing
View Details
Spock2 3'UTR Lenti-reporter-Luc Vector
45363084 1.0 µg

Spock2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human LIM And SH3 Protein 1 (LASP1) CLIA Kit
abx495773-01 96 Tests

Human LIM And SH3 Protein 1 (LASP1) CLIA Kit

Sign In for Pricing
View Details
Human LIM And SH3 Protein 1 (LASP1) CLIA Kit
abx495773-02 5x 96 Tests

Human LIM And SH3 Protein 1 (LASP1) CLIA Kit

Sign In for Pricing
View Details