Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta-specific protein 1 (PLAC1)

Recombinant Human Placenta-specific protein 1 (PLAC1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PLAC1. Accession Number: Q9HBJ0. Expression Region: 23~212aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Placenta-specific protein 1 (PLAC1) is a purified Recombinant Protein.

Accession Number

Q9HBJ0

Expression Region

23~212aa

Host

E. coli

Target

PLAC1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Developmental Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RO-1138452 10mM * 1mL in DMSO
A17137-10mM-D 10 mM x 1mL in DMSO

RO-1138452 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Human NKAPL Pre-designed siRNA Set A
SI010573A 1 Each

Human NKAPL Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human ADAM8 Pre-designed siRNA Set A
SI000269A 1 Each

Human ADAM8 Pre-designed siRNA Set A

Sign In for Pricing
View Details
EG668496 Mouse siRNA Oligo Duplex (Locus ID 668496)
SR407129 1 Kit

EG668496 Mouse siRNA Oligo Duplex (Locus ID 668496)

Sign In for Pricing
View Details
Mouse Monoclonal TSPAN33 Antibody (545422) [DyLight 488]
FAB8405K 0.1 mL

Mouse Monoclonal TSPAN33 Antibody (545422) [DyLight 488]

Sign In for Pricing
View Details
Guanine nucleotide-binding protein-Like 1 (GNL1) Rat ELISA Kit
D9096 96 Tests

Guanine nucleotide-binding protein-Like 1 (GNL1) Rat ELISA Kit

Sign In for Pricing
View Details