Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Diablo homolog, mitochondrial (DIABLO)

Recombinant Human Diablo homolog, mitochondrial (DIABLO) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DIABLO. Target Synonyms: Direct IAP-binding protein with low pI (Second mitochondria-derived activator of caspase; Smac; SMAC) . Accession Number: Q9NR28. Expression Region: 56~239aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 47.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Diablo homolog, mitochondrial (DIABLO) is a purified Recombinant Protein.

Accession Number

Q9NR28

Expression Region

56~239aa

Host

E. coli

Target

DIABLO

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Direct IAP-binding protein with low pI (Second mitochondria-derived activator of caspase; Smac; SMAC)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nestin (NES) (544-776) mouse monoclonal antibody, clone 307501
MO15056-100 100 µg

Nestin (NES) (544-776) mouse monoclonal antibody, clone 307501

Sign In for Pricing
View Details
Recombinant Human MYOZ2 Protein
MBS8249474-01 0.01 mg

Recombinant Human MYOZ2 Protein

Sign In for Pricing
View Details
Recombinant Human MYOZ2 Protein
MBS8249474-02 0.05 mg

Recombinant Human MYOZ2 Protein

Sign In for Pricing
View Details
Recombinant Human MYOZ2 Protein
MBS8249474-03 0.5 mg

Recombinant Human MYOZ2 Protein

Sign In for Pricing
View Details
Recombinant Human MYOZ2 Protein
MBS8249474-04 5x 0.5 mg

Recombinant Human MYOZ2 Protein

Sign In for Pricing
View Details
MIgamma/CXCL9 (Monocyte Interferon Gamma Inducing Factor) Rabbit ELISA Kit
F0064 96 Tests

MIgamma/CXCL9 (Monocyte Interferon Gamma Inducing Factor) Rabbit ELISA Kit

Sign In for Pricing
View Details