Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein SAAL1 (Saal1)

Recombinant Mouse Protein SAAL1 (Saal1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Saal1. Target Synonyms: Synoviocyte proliferation-associated in collagen-induced arthritis protein 1 (SPACIA1) . Accession Number: Q9D2C2. Expression Region: 1~474aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 60.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Protein SAAL1 (Saal1) is a purified Recombinant Protein.

Accession Number

Q9D2C2

Expression Region

1~474aa

Host

E. coli

Target

Saal1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

60.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Synoviocyte proliferation-associated in collagen-induced arthritis protein 1 (SPACIA1)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MDRNPSPPPPTCGSEDEEDLGGGDRIGSTVYSKHWLFGVLSGLIQIVTPESGTSGSADEEEQADLAEEMENEICRVWDMSMDEDVALFLQEFKAPDIFMGVLAKSPCPRLREICVGILGNMACFREICESISKNEDHGQVLLQCLCDSDPPTLLETCRLLLTCLSQTEVASVWVRRIREHPSVYANVCFIMSSSTNVDLLVKVGEVVDKLFDLDEKLMLEWIRKGATRLPGQPHEDSEEQPVFSIVPCVLEAAKQVRSENLEGLDVYMRILQLLTTVDDGVQAIVQCPDTGNDTWRLLFDLVCHEFCQPDDPPVILQEQKTVLASVFSVLSAISASRAEQEHLKIEEGDLPLIDSLIRVLQNMEHCQKKPENPSESDTEEPTICGPTQDDFHMKILKDISCEFLSNIFQVLTKEKVAQGLKEGQLSKQKCSCAFQSLLPLYGPAVEDFVKVVREVDEALADDLEDSFPSVKAQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PPP4R1 Antibody
NBP2-94582-0.1mL 0.1 mL

Rabbit Polyclonal PPP4R1 Antibody

Sign In for Pricing
View Details
MRP3 (ABCC3) (NM_003786) Human Tagged ORF Clone
RC221522 10 µg

MRP3 (ABCC3) (NM_003786) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Protein-export protein secB (secB)
MBS1148152-01 0.02 mg (E-Coli)

Recombinant Vibrio fischeri Protein-export protein secB (secB)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Protein-export protein secB (secB)
MBS1148152-02 0.1 mg (E-Coli)

Recombinant Vibrio fischeri Protein-export protein secB (secB)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Protein-export protein secB (secB)
MBS1148152-03 0.02 mg (Yeast)

Recombinant Vibrio fischeri Protein-export protein secB (secB)

Sign In for Pricing
View Details
Recombinant Vibrio fischeri Protein-export protein secB (secB)
MBS1148152-04 0.1 mg (Yeast)

Recombinant Vibrio fischeri Protein-export protein secB (secB)

Sign In for Pricing
View Details