Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida 2-hydroxymuconate tautomerase (tdnL)

Recombinant Pseudomonas putida 2-hydroxymuconate tautomerase (tdnL) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas putida (Arthrobacter siderocapsulatus) . Target Name: tdnL. Target Synonyms: 4-oxalocrotonate tautomerase. Accession Number: Q93JW0. Expression Region: 2~63aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Pseudomonas putida 2-hydroxymuconate tautomerase (tdnL) is a purified Recombinant Protein.

Accession Number

Q93JW0

Expression Region

2~63aa

Host

E. coli

Target

TdnL

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4-oxalocrotonate tautomerase

Species

Pseudomonas putida (Arthrobacter siderocapsulatus)

Protein Name

Recombinant Protein

AA Sequence

PFAQIYMIEGRTEAQKKAVIEKVSQALVEATGAPMANVRVWIQEVPKENWGIAGVSAKELGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Lamin B Receptor Antibody
NBP2-14185 0.1 mL

Rabbit Polyclonal Lamin B Receptor Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL1F10/ IL-38 Protein, His-SUMO, E.coli-10ug
QP7885-ec-10ug 10ug

Recombinant Mouse IL1F10/ IL-38 Protein, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details
HDAC4 Mouse Monoclonal Antibody [Clone ID: OTI4A4]
CF805010 100 µg

HDAC4 Mouse Monoclonal Antibody [Clone ID: OTI4A4]

Sign In for Pricing
View Details
COPG (COPG1) (NM_016128) Human Over-expression Lysate
LS022820 100 µg

COPG (COPG1) (NM_016128) Human Over-expression Lysate

Sign In for Pricing
View Details
FRK Antibody
33770-01 50 µL

FRK Antibody

Sign In for Pricing
View Details
FRK Antibody
33770-02 100 µL

FRK Antibody

Sign In for Pricing
View Details