Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Secreted phosphoprotein 24 (Spp2)

Recombinant Mouse Secreted phosphoprotein 24 (Spp2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Spp2. Target Synonyms: Spp-24; Secreted phosphoprotein 2. Accession Number: Q8K1I3. Expression Region: 24~203aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Secreted phosphoprotein 24 (Spp2) is a purified Recombinant Protein.

Accession Number

Q8K1I3

Expression Region

24~203aa

Host

E. coli

Target

Spp2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Spp-24; Secreted phosphoprotein 2

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

FPVYDYDPSSLQEALSASVAKVNSQSLSPYLFRATRSSLKRVNVLDEDTLVMNLEFSVQETTCLRDSGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCRWASSSESNSSEEMMFGDMARSHRRRNDYLLGFLSDESRSEQFRDRSLEIMRRGQPPAHRRFLNLHRRARVNSGFE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD11B1, Control Peptide (Corticosteroid 11-beta-dehydrogenase Isozyme 1, 11-beta-hydroxysteroid Dehydrogenase 1, 11-DH, 11-beta-HSD1, HSD11, HSD11L, MGC13539, SDR26C1)
148066 100 µg

HSD11B1, Control Peptide (Corticosteroid 11-beta-dehydrogenase Isozyme 1, 11-beta-hydroxysteroid Dehydrogenase 1, 11-DH, 11-beta-HSD1, HSD11, HSD11L, MGC13539, SDR26C1)

Sign In for Pricing
View Details
Rat Ncstn Pre-designed siRNA Set B
SI209107B 1 Each

Rat Ncstn Pre-designed siRNA Set B

Sign In for Pricing
View Details
LRRC40 Recombinant Protein Antigen
NBP1-82185PEP 0.1 mL

LRRC40 Recombinant Protein Antigen

Sign In for Pricing
View Details
Bovine Integrin beta-1 (ITGB1) ELISA Kit
RK15114 96 Tests

Bovine Integrin beta-1 (ITGB1) ELISA Kit

Sign In for Pricing
View Details
TRAPPC5 (Trafficking Protein Particle Complex Subunit 5, MGC52424) (HRP)
134695-HRP 100 µL

TRAPPC5 (Trafficking Protein Particle Complex Subunit 5, MGC52424) (HRP)

Sign In for Pricing
View Details
Chka (NM_017127) Rat Tagged Lenti ORF Clone
RR201253L3 10 µg

Chka (NM_017127) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details