Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Thymosin beta-10 (Tmsb10)

Recombinant Mouse Thymosin beta-10 (Tmsb10) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Tmsb10. Target Synonyms: Tmsb10; Ptmb10. Accession Number: Q6ZWY8. Expression Region: 2~44aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 17.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Thymosin beta-10 (Tmsb10) is a purified Recombinant Protein.

Accession Number

Q6ZWY8

Expression Region

2~44aa

Host

E. coli

Target

Tmsb10

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Tmsb10; Ptmb10

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSWIM9 Human shRNA Lentiviral Particle (Locus ID 374920)
TL307927V 500 µL Each

ZSWIM9 Human shRNA Lentiviral Particle (Locus ID 374920)

Sign In for Pricing
View Details
3,4-Dihydro-8-methylpyrido[2,3-b]pyrazin-2 (1H) -one
427085-01 50 mg

3,4-Dihydro-8-methylpyrido[2,3-b]pyrazin-2 (1H) -one

Sign In for Pricing
View Details
3,4-Dihydro-8-methylpyrido[2,3-b]pyrazin-2 (1H) -one
427085-02 100 mg

3,4-Dihydro-8-methylpyrido[2,3-b]pyrazin-2 (1H) -one

Sign In for Pricing
View Details
Eef1b2 Rat shRNA Plasmid (Locus ID 363241)
TL707328 1 Kit

Eef1b2 Rat shRNA Plasmid (Locus ID 363241)

Sign In for Pricing
View Details
POLR3F CRISPRa sgRNA lentivector (set of three targets)(Human)
37196121 3x 1.0µg DNA

POLR3F CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
RPE (F-10) Alexa Fluor® 790
sc-393655 AF790 200 µg/mL

RPE (F-10) Alexa Fluor® 790

Sign In for Pricing
View Details