Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Petrosia ficiformis Silicatein

Recombinant Petrosia ficiformis Silicatein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Petrosia ficiformis (Common Mediterranean sponge) . Target Name: Petrosia ficiformis Silicatein. Target Synonyms: Silicatein; EC 3.4.22. Accession Number: Q6YD92. Expression Region: 123~339aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Petrosia ficiformis Silicatein is a purified Recombinant Protein.

Accession Number

Q6YD92

Expression Region

123~339aa

Host

E. coli

Target

Petrosia ficiformis Silicatein

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Silicatein; EC 3.4.22

Species

Petrosia ficiformis (Common Mediterranean sponge)

Protein Name

Recombinant Protein

AA Sequence

LPETVDWRTGGAVTHVKDQLRCGCSYAFAAVGALEGAAALARGRTASLSEQNVLDCSVPYGNHGCSCEDVNNAFMYVIDNGGLDTTSSYPYVSRQYYCKFKSSGVGATATGIVTISSGDESSLESALATAGPVAVYIDASHSSFQFYKYGVLNVPNCSRSKLSHAMILIGYGTTSSKKYWLLKNSWGPNWGISGYIKMSRGMSNQCGIATYASFPTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Adrenal gland
CR562949 5 µg

Tissue Total RNA, Adrenal gland

Sign In for Pricing
View Details
Green Fluorescent FAM-DEVD-OPH in vitro caspase-3/7 Apoptosis Detection Reagent
6356 4x 37.5 µg Vials

Green Fluorescent FAM-DEVD-OPH in vitro caspase-3/7 Apoptosis Detection Reagent

Sign In for Pricing
View Details
ASS1 (Center) Rabbit Polyclonal Antibody
AP17139PU-N 400 µL

ASS1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIV1 p24 Recombinant Rabbit Monoclonal Antibody [PS01-31] - BSA and Azide free (Detector)
HA721528 100 µL

HIV1 p24 Recombinant Rabbit Monoclonal Antibody [PS01-31] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Anti-Rat IgG2c Antibody (HRP)
KH-078-01 50 μL

Anti-Rat IgG2c Antibody (HRP)

Sign In for Pricing
View Details
Anti-Rat IgG2c Antibody (HRP)
KH-078-02 100 µL

Anti-Rat IgG2c Antibody (HRP)

Sign In for Pricing
View Details