Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial

Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ARID4B. Target Synonyms: 180 kDa Sin3-associated polypeptide (Sin3-associated polypeptide p180; Breast cancer-associated antigen BRCAA1; Histone deacetylase complex subunit SAP180; Retinoblastoma-binding protein 1-like 1; ARID domain-containing protein 4B. Accession Number: Q4LE39. Expression Region: 167~415aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human AT-rich interactive domain-containing protein 4B (ARID4B), partial is a purified Recombinant Protein.

Accession Number

Q4LE39

Expression Region

167~415aa

Host

E. coli

Target

ARID4B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

180 kDa Sin3-associated polypeptide (Sin3-associated polypeptide p180; Breast cancer-associated antigen BRCAA1; Histone deacetylase complex subunit SAP180; Retinoblastoma-binding protein 1-like 1; ARID domain-containing protein 4B; BRCAA1; RBBP1L1; RBP1L1; SAP180)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MINA Blocking Peptide
33R-3742 100 ug

MINA Blocking Peptide

Sign In for Pricing
View Details
Veratridine
sc-201075 10 mg

Veratridine

Sign In for Pricing
View Details
PBST with Sodium Azide 20X with 2% Tween 20, pH 7.4
40120181-2 2 L

PBST with Sodium Azide 20X with 2% Tween 20, pH 7.4

Sign In for Pricing
View Details
Rabbit anti-human Tumor necrosis factor ligand superfamily member 14 polyclonal Antibody, Biotin conjugated
MBS715786-01 0.05 mg

Rabbit anti-human Tumor necrosis factor ligand superfamily member 14 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Tumor necrosis factor ligand superfamily member 14 polyclonal Antibody, Biotin conjugated
MBS715786-02 0.1 mg

Rabbit anti-human Tumor necrosis factor ligand superfamily member 14 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Tumor necrosis factor ligand superfamily member 14 polyclonal Antibody, Biotin conjugated
MBS715786-03 5x 0.1 mg

Rabbit anti-human Tumor necrosis factor ligand superfamily member 14 polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details