Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium tepidum Polyphosphate kinase 2 (ppk2), partial

Recombinant Chlorobium tepidum Polyphosphate kinase 2 (ppk2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) . Target Name: ppk2. Target Synonyms: ATP-polyphosphate phosphotransferase 2Polyphosphoric acid kinase 2. Accession Number: O68984. Expression Region: 140~343aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 34.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Chlorobium tepidum Polyphosphate kinase 2 (ppk2), partial is a purified Recombinant Protein.

Accession Number

O68984

Expression Region

140~343aa

Host

E. coli

Target

Ppk2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

34.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ATP-polyphosphate phosphotransferase 2Polyphosphoric acid kinase 2

Species

Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum)

Protein Name

Recombinant Protein

AA Sequence

EQQQLLQHYFRKEVFPVLTPLAFDTGHPFPFMSNLSLNLAIELEDEESGAIKFARVKVPGILSRIIRLDQIEGLGFDDGRIRLLWLEDLVEHNLDQLFPKMRILQCHPFRIIRDADIEIEEDEAGDLLESIEQGVRSRRYGKVVRLDINPDMPHSIRSLLVKNLETYERNVYEIGGVLGMSALMELLKIDRPDLKDELFVPNNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM174 knockdown cell line
ABC-KD15611 1 Vial

Human TMEM174 knockdown cell line

Sign In for Pricing
View Details
Ppp1r13b (NM_011625) Mouse Untagged Clone
MC223508 10 µg

Ppp1r13b (NM_011625) Mouse Untagged Clone

Sign In for Pricing
View Details
Human NG2/MCSP/CSPG4 Affinity Purified Polyclonal Ab
AF2585-SP 25 µg

Human NG2/MCSP/CSPG4 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
CYP2U1 Antibody
MBS7131065-01 0.1 mL

CYP2U1 Antibody

Sign In for Pricing
View Details
CYP2U1 Antibody
MBS7131065-02 5x 0.1 mL

CYP2U1 Antibody

Sign In for Pricing
View Details
SVOPL Double Nickase Plasmid (m)
sc-435790-NIC 20 µg

SVOPL Double Nickase Plasmid (m)

Sign In for Pricing
View Details