Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bubalus bubalis Lingual antimicrobial peptide

Recombinant Bubalus bubalis Lingual antimicrobial peptide is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bubalus bubalis (Domestic water buffalo) . Target Name: Bubalus bubalis Lingual antimicrobial peptide. Target Synonyms: Lingual antimicrobial peptide. Accession Number: A3RJ36. Expression Region: 25~64aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 19.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bubalus bubalis Lingual antimicrobial peptide is a purified Recombinant Protein.

Accession Number

A3RJ36

Expression Region

25~64aa

Host

E. coli

Target

Bubalus bubalis Lingual antimicrobial peptide

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Ksi-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Lingual antimicrobial peptide

Species

Bubalus bubalis (Domestic water buffalo)

Protein Name

Recombinant Protein

AA Sequence

VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPMI 1640 Medium w/o L-Glutamine, Calcium Free (Liquid)
R8999-02A-L 500 mL

RPMI 1640 Medium w/o L-Glutamine, Calcium Free (Liquid)

Sign In for Pricing
View Details
1- (2-Chlorophenyl) -5-ethyl-1H-1,2,4-triazole-3-carboxylic acid
EWB37281-01 100 mg

1- (2-Chlorophenyl) -5-ethyl-1H-1,2,4-triazole-3-carboxylic acid

Sign In for Pricing
View Details
1- (2-Chlorophenyl) -5-ethyl-1H-1,2,4-triazole-3-carboxylic acid
EWB37281-02 1 g

1- (2-Chlorophenyl) -5-ethyl-1H-1,2,4-triazole-3-carboxylic acid

Sign In for Pricing
View Details
IPSC-Derived Cardiomyocyte Kit
ILC-2005 1 Kit

IPSC-Derived Cardiomyocyte Kit

Sign In for Pricing
View Details
GSC2 Antibody
orb1554941-01 50 μL

GSC2 Antibody

Sign In for Pricing
View Details
GSC2 Antibody
orb1554941-02 100 µL

GSC2 Antibody

Sign In for Pricing
View Details