Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1)

Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) . Target Name: BCRF1. Target Synonyms: 20 kDa protein (Protein BCRF1; vIL-10) . Accession Number: P03180. Expression Region: 24~170aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1) is a purified Recombinant Protein.

Accession Number

P03180

Expression Region

24~170aa

Host

E. coli

Target

BCRF1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

20 kDa protein (Protein BCRF1; vIL-10)

Species

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Protein Name

Recombinant Protein

AA Sequence

TDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Gamma-Aminobutyric Acid Receptor Subunit Rho-2 (GABRR2) ELISA Kit
MBS9373194 Inquire

Fish Gamma-Aminobutyric Acid Receptor Subunit Rho-2 (GABRR2) ELISA Kit

Sign In for Pricing
View Details
MPPED1 (Metallophosphoesterase Domain-containing Protein 1, Adult Brain Protein 239, 239AB, C22orf1, FAM1A)
MBS641424-01 0.05 mg

MPPED1 (Metallophosphoesterase Domain-containing Protein 1, Adult Brain Protein 239, 239AB, C22orf1, FAM1A)

Sign In for Pricing
View Details
MPPED1 (Metallophosphoesterase Domain-containing Protein 1, Adult Brain Protein 239, 239AB, C22orf1, FAM1A)
MBS641424-02 5x 0.05 mg

MPPED1 (Metallophosphoesterase Domain-containing Protein 1, Adult Brain Protein 239, 239AB, C22orf1, FAM1A)

Sign In for Pricing
View Details
ZFP36L1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
50941151 3x 1.0 µg DNA

ZFP36L1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
KHK Knockout Cell Lysate
ABC-KC0981 100 µg

KHK Knockout Cell Lysate

Sign In for Pricing
View Details
SIRP beta 1, Human (Biotinylated, HEK293, C-His-Avi)
HY-P700827 1 Each

SIRP beta 1, Human (Biotinylated, HEK293, C-His-Avi)

Sign In for Pricing
View Details