Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1)

Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) . Target Name: BCRF1. Target Synonyms: 20 kDa protein (Protein BCRF1; vIL-10) . Accession Number: P03180. Expression Region: 24~170aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1) is a purified Recombinant Protein.

Accession Number

P03180

Expression Region

24~170aa

Host

E. coli

Target

BCRF1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

20 kDa protein (Protein BCRF1; vIL-10)

Species

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Protein Name

Recombinant Protein

AA Sequence

TDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP8 (UBPY) Antibody (C-term) Blocking Peptide
MBS9231490-01 0.5 mg

USP8 (UBPY) Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
USP8 (UBPY) Antibody (C-term) Blocking Peptide
MBS9231490-02 5x 0.5 mg

USP8 (UBPY) Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Recombinant Mouse RAET1C Protein, His (Fc)-Avi-tagged
RAET1C-7397M 50 µg

Recombinant Mouse RAET1C Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
LCLAT1 Protein Vector (Mouse) (pPM-C-His)
PV196053 500 ng

LCLAT1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CARD11 sgRNA CRISPR Lentivector (Human) (Target 1)
K0363002 1.0 µg DNA

CARD11 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PARP12 Polyclonal Antibody
MBS9134322-01 0.02 mL

PARP12 Polyclonal Antibody

Sign In for Pricing
View Details