Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS)

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) . Target Name: ybiS. Target Synonyms: Probable L, D-transpeptidase YbiS (EC 2.-.-.-) . Accession Number: P0AAX9. Expression Region: 25~306aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS) is a purified Recombinant Protein.

Accession Number

P0AAX9

Expression Region

25~306aa

Host

E. coli

Target

YbiS

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Probable L, D-transpeptidase YbiS (EC 2.-.-.-)

Species

E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Protein Name

Recombinant Protein

AA Sequence

VTYPLPTDGSRLVGQNQVITIPEGNTQPLEYFAAEYQMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPMGLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLFEKVPVGTRVQFIDEPVKATTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQTVTGQPDVDQVVLDEAIKNRSGMPVRLN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map7d2 Mouse shRNA Plasmid (Locus ID 78283)
TL517873 1 Kit

Map7d2 Mouse shRNA Plasmid (Locus ID 78283)

Sign In for Pricing
View Details
Fam214a (NM_001106838) Rat Tagged Lenti ORF Clone
RR212787L4 10 µg

Fam214a (NM_001106838) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MARCH8 (E3 Ubiquitin-Protein Ligase MARCH8, Membrane-Associated Ring Finger (C3HC4) 8, E3 Ubiquitin Protein Ligase)
485445 100 µL

MARCH8 (E3 Ubiquitin-Protein Ligase MARCH8, Membrane-Associated Ring Finger (C3HC4) 8, E3 Ubiquitin Protein Ligase)

Sign In for Pricing
View Details
Bovine Tctex1 domain-containing protein 2, TCTEX1D2 ELISA KIT
ELI-18828b 96 Tests

Bovine Tctex1 domain-containing protein 2, TCTEX1D2 ELISA KIT

Sign In for Pricing
View Details
Zbbx-set siRNA/shRNA/RNAi Lentivector (Rat)
50675096 4x 500 ng

Zbbx-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
CDH8 polyclonal antibody
BS75658-01 50 µL

CDH8 polyclonal antibody

Sign In for Pricing
View Details