Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS)

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) . Target Name: ybiS. Target Synonyms: Probable L, D-transpeptidase YbiS (EC 2.-.-.-) . Accession Number: P0AAX9. Expression Region: 25~306aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS) is a purified Recombinant Protein.

Accession Number

P0AAX9

Expression Region

25~306aa

Host

E. coli

Target

YbiS

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Probable L, D-transpeptidase YbiS (EC 2.-.-.-)

Species

E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Protein Name

Recombinant Protein

AA Sequence

VTYPLPTDGSRLVGQNQVITIPEGNTQPLEYFAAEYQMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPMGLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLFEKVPVGTRVQFIDEPVKATTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQTVTGQPDVDQVVLDEAIKNRSGMPVRLN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-Syvn1-shRNA2-CopGFP-Puro Plasmid
PVT67098 2 µg

PLV3-U6-Syvn1-shRNA2-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
GSTO2 (NM_001191015) Human Over-expression Lysate
LY434025 100 µg

GSTO2 (NM_001191015) Human Over-expression Lysate

Sign In for Pricing
View Details
LATS1 (NM_004690) Human Untagged Clone
SC323703 10 µg

LATS1 (NM_004690) Human Untagged Clone

Sign In for Pricing
View Details
CLU, NT (CLU, APOJ, CLI, KUB1, Clusterin, Aging-associated gene 4 protein, Apolipoprotein J, Complement cytolysis inhibitor, Complement-associated protein SP-40,40, Ku70-binding protein 1, NA1/NA2, Testosterone-repressed prostate message 2, Clusterin beta chain, ApoJalpha, Complement cytolysis inhibitor a chain, Clusterin alpha chain, ApoJbeta, Complement cytolysis inhibitor b chain) (MaxLight 550) discontinued
034021-ML550 100 µL

CLU, NT (CLU, APOJ, CLI, KUB1, Clusterin, Aging-associated gene 4 protein, Apolipoprotein J, Complement cytolysis inhibitor, Complement-associated protein SP-40,40, Ku70-binding protein 1, NA1/NA2, Testosterone-repressed prostate message 2, Clusterin beta chain, ApoJalpha, Complement cytolysis inhibitor a chain, Clusterin alpha chain, ApoJbeta, Complement cytolysis inhibitor b chain) (MaxLight 550) discontinued

Sign In for Pricing
View Details
HLA-DRB1 (Biotin)
319269-01 50 µg

HLA-DRB1 (Biotin)

Sign In for Pricing
View Details
HLA-DRB1 (Biotin)
319269-02 100 µg

HLA-DRB1 (Biotin)

Sign In for Pricing
View Details