Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS)

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) . Target Name: ybiS. Target Synonyms: Probable L, D-transpeptidase YbiS (EC 2.-.-.-) . Accession Number: P0AAX9. Expression Region: 25~306aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli O6:H1 Probable L, D-transpeptidase YbiS (ybiS) is a purified Recombinant Protein.

Accession Number

P0AAX9

Expression Region

25~306aa

Host

E. coli

Target

YbiS

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Probable L, D-transpeptidase YbiS (EC 2.-.-.-)

Species

E. coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Protein Name

Recombinant Protein

AA Sequence

VTYPLPTDGSRLVGQNQVITIPEGNTQPLEYFAAEYQMGLSNMMEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTVIVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPMGLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNEDIKFLFEKVPVGTRVQFIDEPVKATTEPDGSRYIEVHNPLSTTEAQFEGQEIVPITLTKSVQTVTGQPDVDQVVLDEAIKNRSGMPVRLN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1412705 3x 1.0 µg

NDUFS2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
THEM5 Protein Lysate (Human) with C-Ha Tag
46651031 100 µg

THEM5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Nat8f4 (NM_001145895) Mouse Tagged ORF Clone Lentiviral Particle
MR212741L4V 200 µL

Nat8f4 (NM_001145895) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MCM7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV636614 1.0 µg DNA

MCM7 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PDZ And LIM Domain Protein 1 (PDLIM1) Antibody
abx241898-01 50 µL

PDZ And LIM Domain Protein 1 (PDLIM1) Antibody

Sign In for Pricing
View Details
PDZ And LIM Domain Protein 1 (PDLIM1) Antibody
abx241898-02 100 µL

PDZ And LIM Domain Protein 1 (PDLIM1) Antibody

Sign In for Pricing
View Details