Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lens culinaris Lectin

Recombinant Lens culinaris Lectin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lens culinaris (Lentil) (Cicer lens) . Target Name: Lens culinaris Lectin. Accession Number: P02870. Expression Region: 31~210aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Lens culinaris Lectin is a purified Recombinant Protein.

Accession Number

P02870

Expression Region

31~210aa

Host

E. coli

Target

Lens culinaris Lectin

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Lens culinaris (Lentil) (Cicer lens)

Protein Name

Recombinant Protein

AA Sequence

TETTSFSITKFSPDQKNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADEFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse CD3 mAb (PE/Cy5.5)
orb2710730 100 Tests

Rat Anti-Mouse CD3 mAb (PE/Cy5.5)

Sign In for Pricing
View Details
Anti-Fractin Antibody
592-FRAC 100 µL

Anti-Fractin Antibody

Sign In for Pricing
View Details
FoxL1 Polyclonal Antibody
MBS9243689-01 0.1 mL

FoxL1 Polyclonal Antibody

Sign In for Pricing
View Details
FoxL1 Polyclonal Antibody
MBS9243689-02 5x 0.1 mL

FoxL1 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Soluble Farnesoid Xreceptor FXR ELISA Kit
BG-RAT11011 1 Each

Rat Soluble Farnesoid Xreceptor FXR ELISA Kit

Sign In for Pricing
View Details
GUCA1C (GCAP3, Guanylyl Cyclase-activating Protein 3, Guanylate Cyclase Activator 1C) (MaxLight 490)
MBS6201138-01 0.1 mL

GUCA1C (GCAP3, Guanylyl Cyclase-activating Protein 3, Guanylate Cyclase Activator 1C) (MaxLight 490)

Sign In for Pricing
View Details