Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stefin-1 (Stfa1)

Recombinant Mouse Stefin-1 (Stfa1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Stfa1. Target Synonyms: Stfa1; Stf-1; Stf1Stefin-1. Accession Number: P35175. Expression Region: 1~97aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Stefin-1 (Stfa1) is a purified Recombinant Protein.

Accession Number

P35175

Expression Region

1~97aa

Host

E. coli

Target

Stfa1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Stfa1; Stf-1; Stf1Stefin-1

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

MSLGGVSEASRATPEIQMIANKVRPQLEAKTNKKYEKFEAVEYKTQVVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTMDEELTYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTK9 (Twinfilin, Actin-Binding Protein, Homolog 1 (Drosophila), A6, MGC23788, MGC41876, PTK9) (FITC)
MBS6174934-01 0.1 mL

PTK9 (Twinfilin, Actin-Binding Protein, Homolog 1 (Drosophila), A6, MGC23788, MGC41876, PTK9) (FITC)

Sign In for Pricing
View Details
PTK9 (Twinfilin, Actin-Binding Protein, Homolog 1 (Drosophila), A6, MGC23788, MGC41876, PTK9) (FITC)
MBS6174934-02 5x 0.1 mL

PTK9 (Twinfilin, Actin-Binding Protein, Homolog 1 (Drosophila), A6, MGC23788, MGC41876, PTK9) (FITC)

Sign In for Pricing
View Details
Human GAGE2D Protein
orb425632-01 2 µg

Human GAGE2D Protein

Sign In for Pricing
View Details
Human GAGE2D Protein
orb425632-02 10 µg

Human GAGE2D Protein

Sign In for Pricing
View Details
Human GAGE2D Protein
orb425632-03 1 mg

Human GAGE2D Protein

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Moesin (MSN)
MBS2067364-01 0.1 mL

HRP-Linked Polyclonal Antibody to Moesin (MSN)

Sign In for Pricing
View Details