Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ)

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) . Target Name: yafQ. Accession Number: P44041. Expression Region: 1~102aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein.

Accession Number

P44041

Expression Region

1~102aa

Host

E. coli

Target

YafQ

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Protein Name

Recombinant Protein

AA Sequence

MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYVIQDEFDELKFSRLNIHSQTALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg7 Mouse shRNA Lentiviral Particle (Locus ID 74244)
TL504956V 500 µL Each

Atg7 Mouse shRNA Lentiviral Particle (Locus ID 74244)

Sign In for Pricing
View Details
hsa-miR-4758-5p miRNA Mimic
MBS8299683-01 5 nmol

hsa-miR-4758-5p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-4758-5p miRNA Mimic
MBS8299683-02 10 nmol

hsa-miR-4758-5p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-4758-5p miRNA Mimic
MBS8299683-03 5x 10 nmol

hsa-miR-4758-5p miRNA Mimic

Sign In for Pricing
View Details
Recombinant Bacteroides fragilis DNA repair protein recO (recO)
MBS1359156-01 0.02 mg (E-Coli)

Recombinant Bacteroides fragilis DNA repair protein recO (recO)

Sign In for Pricing
View Details
Recombinant Bacteroides fragilis DNA repair protein recO (recO)
MBS1359156-02 0.1 mg (E-Coli)

Recombinant Bacteroides fragilis DNA repair protein recO (recO)

Sign In for Pricing
View Details