Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ)

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) . Target Name: yafQ. Accession Number: P44041. Expression Region: 1~102aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein.

Accession Number

P44041

Expression Region

1~102aa

Host

E. coli

Target

YafQ

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Protein Name

Recombinant Protein

AA Sequence

MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYVIQDEFDELKFSRLNIHSQTALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FK506 Binding Protein 4 (FKBP4) ELISA Kit
RD-FKBP4-Hu-01 96 Tests

Human FK506 Binding Protein 4 (FKBP4) ELISA Kit

Sign In for Pricing
View Details
Human FK506 Binding Protein 4 (FKBP4) ELISA Kit
RD-FKBP4-Hu-02 48 Tests

Human FK506 Binding Protein 4 (FKBP4) ELISA Kit

Sign In for Pricing
View Details
pBLOOK, LED Transilluminator, Navy Blue
BK002-00BU 1 Set

pBLOOK, LED Transilluminator, Navy Blue

Sign In for Pricing
View Details
ALDH1A2 Antibody - middle region
MBS3222364-01 0.1 mL

ALDH1A2 Antibody - middle region

Sign In for Pricing
View Details
ALDH1A2 Antibody - middle region
MBS3222364-02 5x 0.1 mL

ALDH1A2 Antibody - middle region

Sign In for Pricing
View Details
mmu-miR-3064-3p miRNA Agomir
MBS8313984-01 5 nmol

mmu-miR-3064-3p miRNA Agomir

Sign In for Pricing
View Details