Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ)

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) . Target Name: yafQ. Accession Number: P44041. Expression Region: 1~102aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein.

Accession Number

P44041

Expression Region

1~102aa

Host

E. coli

Target

YafQ

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Protein Name

Recombinant Protein

AA Sequence

MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYVIQDEFDELKFSRLNIHSQTALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klf13 (NM_001109147) Rat Tagged ORF Clone
RR207338 10 µg

Klf13 (NM_001109147) Rat Tagged ORF Clone

Sign In for Pricing
View Details
TAK-778 50mg
A12275-50 50 mg

TAK-778 50mg

Sign In for Pricing
View Details
GPR116 sgRNA CRISPR Lentivector set (Human)
K0895501 3x 1.0 µg

GPR116 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Microtus pennsylvanicus Cytochrome c oxidase subunit 2 (MT-CO2), partial
MBS7055911 Inquire

Recombinant Microtus pennsylvanicus Cytochrome c oxidase subunit 2 (MT-CO2), partial

Sign In for Pricing
View Details
Rabbit Polyclonal Aminopeptidase P1/XPNPEP1 Antibody
NBP2-98604-100ul 100 µL

Rabbit Polyclonal Aminopeptidase P1/XPNPEP1 Antibody

Sign In for Pricing
View Details
MAPK6 Rabbit Polyclonal Antibody
TA378313 100 µL

MAPK6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details