Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ)

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) . Target Name: yafQ. Accession Number: P44041. Expression Region: 1~102aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein.

Accession Number

P44041

Expression Region

1~102aa

Host

E. coli

Target

YafQ

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Protein Name

Recombinant Protein

AA Sequence

MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYVIQDEFDELKFSRLNIHSQTALK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Capns2 shRNA (UAS) - Lentiviral mouse Capns2 shRNA (UAS, iRFP) (100)
GTR15262899 1 Vial

Lentiviral mouse Capns2 shRNA (UAS) - Lentiviral mouse Capns2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (AP)
MBS6498581-01 0.1 mL

SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (AP)

Sign In for Pricing
View Details
SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (AP)
MBS6498581-02 5x 0.1 mL

SCF (Stem Cell Factor, CD117 c-kit, Steel Factor, Mast Cell Growth Factor, MGF) (AP)

Sign In for Pricing
View Details
pENTR223-PPID vector Plasmid
PVT12013 2 µg

pENTR223-PPID vector Plasmid

Sign In for Pricing
View Details
Mouse Epigen, Epgn ELISA KIT
ELI-20501m 96 Tests

Mouse Epigen, Epgn ELISA KIT

Sign In for Pricing
View Details
Adenylate Kinase Isoenzyme 5 (AK5) Human ELISA Kit
B2907 96 Tests

Adenylate Kinase Isoenzyme 5 (AK5) Human ELISA Kit

Sign In for Pricing
View Details