Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21)

Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: HSP21. Target Synonyms: 25.3 kDa heat shock protein, chloroplastic. Accession Number: P31170. Expression Region: 44~227aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21) is a purified Recombinant Protein.

Accession Number

P31170

Expression Region

44~227aa

Host

E. coli

Target

HSP21

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

25.3 kDa heat shock protein, chloroplastic

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

AQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1; Ccnd1 Protein (N-His, Human)
P514661 100 µg

Cyclin D1; Ccnd1 Protein (N-His, Human)

Sign In for Pricing
View Details
PPP2R2B (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta, FLJ95686, MGC24888) (FITC)
MBS6390453-01 0.1 mL

PPP2R2B (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta, FLJ95686, MGC24888) (FITC)

Sign In for Pricing
View Details
PPP2R2B (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta, FLJ95686, MGC24888) (FITC)
MBS6390453-02 5x 0.1 mL

PPP2R2B (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta, FLJ95686, MGC24888) (FITC)

Sign In for Pricing
View Details
PSG8 (Pregnancy-Specific Beta-1-Glycoprotein 8)
489562 100 µL

PSG8 (Pregnancy-Specific Beta-1-Glycoprotein 8)

Sign In for Pricing
View Details
MERTK/MER Protein (C-hFc, Mouse)
P516874 100 µg

MERTK/MER Protein (C-hFc, Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 14 Antibody (KRT14/8261R) [Alexa Fluor 750]
NBP3-24292AF750 0.1 mL

Rabbit Monoclonal Cytokeratin 14 Antibody (KRT14/8261R) [Alexa Fluor 750]

Sign In for Pricing
View Details