Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21)

Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress) . Target Name: HSP21. Target Synonyms: 25.3 kDa heat shock protein, chloroplastic. Accession Number: P31170. Expression Region: 44~227aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21) is a purified Recombinant Protein.

Accession Number

P31170

Expression Region

44~227aa

Host

E. coli

Target

HSP21

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

25.3 kDa heat shock protein, chloroplastic

Species

Arabidopsis thaliana (Mouse-ear cress)

Protein Name

Recombinant Protein

AA Sequence

AQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf163 3'UTR Luciferase Stable Cell Line
TU002101 1.0 mL

C1orf163 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BDKRB1 Over-expression Lysate Product
GWB-F0AEFA 0.1 mg

BDKRB1 Over-expression Lysate Product

Sign In for Pricing
View Details
B4galt3 Rabbit Polyclonal Antibody
TA356555 100 µL

B4galt3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEGR1 Antibody, Biotin conjugated
MBS1498710-01 0.05 mg

NEGR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
NEGR1 Antibody, Biotin conjugated
MBS1498710-02 0.1 mg

NEGR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
NEGR1 Antibody, Biotin conjugated
MBS1498710-03 5x 0.1 mg

NEGR1 Antibody, Biotin conjugated

Sign In for Pricing
View Details