Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated

Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: MOV-Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: Il11. Target Synonyms: IL-11. Accession Number: P20808. Expression Region: 22~199aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 67.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Macaca fascicularis Interleukin-11 (IL11), Biotinylated is a purified Recombinant Protein.

Accession Number

P20808

Expression Region

22~199aa

Host

E. coli

Target

Il11

Conjugation

Unconjugated

Tag

N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

67.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-11

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Recombinant Protein

AA Sequence

PGPPPGSPRASPDPRAELDSTVLLTRSLLEDTRQLTIQLKDKFPADGDHNLDSLPTLAMSAGALGALQLPSVLTRLRADLLSYLRHVQWLRRAMGSSLKTLEPELGTLQTRLDRLLRRLQLLMSRLALPQLPPDPPAPPLAPPSSTWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ku-70 (X-Ray Repair Cross-Complementing Protein 6, 5'-deoxyribose-5-phosphate Lyase Ku70, 5'-dRP Lyase Ku70, 70kD Subunit of Ku Antigen, ATP-Dependent DNA Helicase 2 Subunit 1, ATP-Dependent DNA Helicase II 70kD Subunit, CTC box-Binding Factor 75kD Subunit, CTC75, CTCBF, DNA Repair Protein XRCC6, Lupus Ku Autoantigen Protein p70, Ku70, Thyroid-lupus Autoantigen, TLAA, X-Ray Repair Complementing defective Repair in, Chinese hamster Cells 6, XRCC6, G22P1) discontinued
223836-01 50 µL

Ku-70 (X-Ray Repair Cross-Complementing Protein 6, 5'-deoxyribose-5-phosphate Lyase Ku70, 5'-dRP Lyase Ku70, 70kD Subunit of Ku Antigen, ATP-Dependent DNA Helicase 2 Subunit 1, ATP-Dependent DNA Helicase II 70kD Subunit, CTC box-Binding Factor 75kD Subunit, CTC75, CTCBF, DNA Repair Protein XRCC6, Lupus Ku Autoantigen Protein p70, Ku70, Thyroid-lupus Autoantigen, TLAA, X-Ray Repair Complementing defective Repair in, Chinese hamster Cells 6, XRCC6, G22P1) discontinued

Ask
View Details
Ku-70 (X-Ray Repair Cross-Complementing Protein 6, 5'-deoxyribose-5-phosphate Lyase Ku70, 5'-dRP Lyase Ku70, 70kD Subunit of Ku Antigen, ATP-Dependent DNA Helicase 2 Subunit 1, ATP-Dependent DNA Helicase II 70kD Subunit, CTC box-Binding Factor 75kD Subunit, CTC75, CTCBF, DNA Repair Protein XRCC6, Lupus Ku Autoantigen Protein p70, Ku70, Thyroid-lupus Autoantigen, TLAA, X-Ray Repair Complementing defective Repair in, Chinese hamster Cells 6, XRCC6, G22P1) discontinued
223836-02 100 µL

Ku-70 (X-Ray Repair Cross-Complementing Protein 6, 5'-deoxyribose-5-phosphate Lyase Ku70, 5'-dRP Lyase Ku70, 70kD Subunit of Ku Antigen, ATP-Dependent DNA Helicase 2 Subunit 1, ATP-Dependent DNA Helicase II 70kD Subunit, CTC box-Binding Factor 75kD Subunit, CTC75, CTCBF, DNA Repair Protein XRCC6, Lupus Ku Autoantigen Protein p70, Ku70, Thyroid-lupus Autoantigen, TLAA, X-Ray Repair Complementing defective Repair in, Chinese hamster Cells 6, XRCC6, G22P1) discontinued

Ask
View Details
Impa1 (NM_032057) Rat Tagged Lenti ORF Clone
RR208568L4 10 µg

Impa1 (NM_032057) Rat Tagged Lenti ORF Clone

Ask
View Details
Jph4 (BC052049) Mouse Untagged Clone
MC218681 10 µg

Jph4 (BC052049) Mouse Untagged Clone

Ask
View Details
Human NRG-1(Neuregulin 1) ELISA Kit
SYP-H0649-01 48 Well

Human NRG-1(Neuregulin 1) ELISA Kit

Ask
View Details
Human NRG-1(Neuregulin 1) ELISA Kit
SYP-H0649-02 96 Well

Human NRG-1(Neuregulin 1) ELISA Kit

Ask
View Details