Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Nucleoprotein (N)

Recombinant Human coronavirus 229E Nucleoprotein (N) is a purified Recombinant Protein; Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human coronavirus 229E (HCoV-229E) . Target Name: N. Target Synonyms: Nucleocapsid protein; NC; Protein N. Accession Number: P15130. Expression Region: 1~389aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 44.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human coronavirus 229E Nucleoprotein (N) is a purified Recombinant Protein; Coronavirus Protein.

Accession Number

P15130

Expression Region

1~389aa

Host

E. coli

Target

N

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Microbiology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Nucleocapsid protein; NC; Protein N

Species

Human coronavirus 229E (HCoV-229E)

Protein Name

Recombinant Coronavirus Protein

AA Sequence

MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromodeoxyuridine (Bromodeoxyuridine, BUdr, BrdU) (BSA & Azide Free) (MaxLight 650)
168652-AF-ML650 100 µL

Bromodeoxyuridine (Bromodeoxyuridine, BUdr, BrdU) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
PAQR4 Protein Vector (Rat) (pPM-C-His)
PV292385 500 ng

PAQR4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Immuno HRP-DAB, Anti-Chicken IgY (H+L)
IH-8053-15 Each Reagent 15 mL

Immuno HRP-DAB, Anti-Chicken IgY (H+L)

Sign In for Pricing
View Details
Monoclonal Antibody to Huntingtin Associated Protein 1 (HAP1)
TRV-0060278-01 20 µL

Monoclonal Antibody to Huntingtin Associated Protein 1 (HAP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Huntingtin Associated Protein 1 (HAP1)
TRV-0060278-02 100 µL

Monoclonal Antibody to Huntingtin Associated Protein 1 (HAP1)

Sign In for Pricing
View Details
Monoclonal Antibody to Huntingtin Associated Protein 1 (HAP1)
TRV-0060278-03 200 µL

Monoclonal Antibody to Huntingtin Associated Protein 1 (HAP1)

Sign In for Pricing
View Details