Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Viscum album Chitin-binding lectin

Recombinant Viscum album Chitin-binding lectin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Viscum album (European mistletoe) . Target Name: Viscum album Chitin-binding lectin. Accession Number: P81859. Expression Region: 1~49aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 32.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Viscum album Chitin-binding lectin is a purified Recombinant Protein.

Accession Number

P81859

Expression Region

1~49aa

Host

E. coli

Target

Viscum album Chitin-binding lectin

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Viscum album (European mistletoe)

Protein Name

Recombinant Protein

AA Sequence

IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SIRT2 Antibody (4V247)
TMAC-03763-01 50 μL

Anti-SIRT2 Antibody (4V247)

Sign In for Pricing
View Details
Anti-SIRT2 Antibody (4V247)
TMAC-03763-02 100 µL

Anti-SIRT2 Antibody (4V247)

Sign In for Pricing
View Details
Porcine Gastrotropin,FABP6 ELISA KIT
ELI-07186p 96 Tests

Porcine Gastrotropin,FABP6 ELISA KIT

Sign In for Pricing
View Details
Lentiviral human IFITM2 shRNA (UAS) - Lentiviral human IFITM2 shRNA (UAS, iRFP) (100)
GTR15345414 1 Vial

Lentiviral human IFITM2 shRNA (UAS) - Lentiviral human IFITM2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Lauryl Sulfate Agar
1309 500 g

Lauryl Sulfate Agar

Sign In for Pricing
View Details
PLV3-CMV-PLEK2-3xFLAG-CopGFP-Puro Plasmid
PVT69718 2 µg

PLV3-CMV-PLEK2-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details