Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Viscum album Chitin-binding lectin

Recombinant Viscum album Chitin-binding lectin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Viscum album (European mistletoe) . Target Name: Viscum album Chitin-binding lectin. Accession Number: P81859. Expression Region: 1~49aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 32.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Viscum album Chitin-binding lectin is a purified Recombinant Protein.

Accession Number

P81859

Expression Region

1~49aa

Host

E. coli

Target

Viscum album Chitin-binding lectin

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Viscum album (European mistletoe)

Protein Name

Recombinant Protein

AA Sequence

IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHG3 Protein Vector (Human) (pPM-C-HA)
36990021 500 ng

PLEKHG3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Spi-C (h) -PR
sc-76561-PR 10 µM - 20 µL

Spi-C (h) -PR

Sign In for Pricing
View Details
Rabbit Anti-NLRC5 antibody
SL19284R-01 50 µL

Rabbit Anti-NLRC5 antibody

Sign In for Pricing
View Details
Rabbit Anti-NLRC5 antibody
SL19284R-02 100 µL

Rabbit Anti-NLRC5 antibody

Sign In for Pricing
View Details
FGFR6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0780408 1.0 µg DNA

FGFR6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
KCNH4 shRNA (h) Lentiviral Particles
sc-93952-V 200 µL

KCNH4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details