Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma pneumoniae Protein P200 (p200), partial

Recombinant Mycoplasma pneumoniae Protein P200 (p200), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycoplasma pneumoniae (strain ATCC 29342 / M129) . Target Name: p200. Target Synonyms: p200; MPN_567; MP275; Protein P200. Accession Number: P75211. Expression Region: 857~985aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mycoplasma pneumoniae Protein P200 (p200), partial is a purified Recombinant Protein.

Accession Number

P75211

Expression Region

857~985aa

Host

E. coli

Target

P200

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

P200; MPN_567; MP275; Protein P200

Species

Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Protein Name

Recombinant Protein

AA Sequence

LDWELLIGNSNYGHYEPSGEWVWAGYFDDNQIWTPDASVEWARESDYTDLIGDEIYGRYNRKGEWIWYGYYDETGEWVLVDEHYQNHQPRISEAPRFWEQLIGNEDYGYYEDNEWKWYDGEFDSEGNWL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

5 (E),9 (Z),12 (Z)-Octadecatrienoic Acid
MBS392118-01 5 mg

5 (E),9 (Z),12 (Z)-Octadecatrienoic Acid

Sign In for Pricing
View Details
5 (E),9 (Z),12 (Z)-Octadecatrienoic Acid
MBS392118-02 5x 5 mg

5 (E),9 (Z),12 (Z)-Octadecatrienoic Acid

Sign In for Pricing
View Details
IGF2 Antibody (Center R54) Blocking peptide
MBS9218232-01 0.5 mg

IGF2 Antibody (Center R54) Blocking peptide

Sign In for Pricing
View Details
IGF2 Antibody (Center R54) Blocking peptide
MBS9218232-02 5x 0.5 mg

IGF2 Antibody (Center R54) Blocking peptide

Sign In for Pricing
View Details
Rab3ip sgRNA CRISPR Lentivector set (Mouse)
K4961801 3x 1.0 µg

Rab3ip sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Arsa (NM_001034933) Rat Tagged ORF Clone
RR208057 10 µg

Arsa (NM_001034933) Rat Tagged ORF Clone

Sign In for Pricing
View Details