Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein

Recombinant Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2) . Target Name: Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein. Target Synonyms: E3-19KE3gp 19 kDaE19GP19K. Accession Number: P68978. Expression Region: 18~123aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein is a purified Recombinant Protein.

Accession Number

P68978

Expression Region

18~123aa

Host

E. coli

Target

Human adenovirus C serotype 2 Early E3 18.5 kDa glycoprotein

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

E3-19KE3gp 19 kDaE19GP19K

Species

Human adenovirus C serotype 2 (HAdV-2) (Human adenovirus 2)

Protein Name

Recombinant Protein

AA Sequence

AKKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPGDTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQKCLENTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbon(isothiocyanatidic)acid Ethyl Ester
TRC-C176650-1G 1 g

Carbon(isothiocyanatidic)acid Ethyl Ester

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS639877 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS621064 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
Recombinant Folate Binding Protein Antibody
RC-5228-01 50 μL

Recombinant Folate Binding Protein Antibody

Sign In for Pricing
View Details
Recombinant Folate Binding Protein Antibody
RC-5228-02 100 µL

Recombinant Folate Binding Protein Antibody

Sign In for Pricing
View Details
Recombinant Folate Binding Protein Antibody
RC-5228-03 1 mL

Recombinant Folate Binding Protein Antibody

Sign In for Pricing
View Details