Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292)

Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIMB 10654) (Clostridium sticklandii) . Target Name: CLOST_2292. Target Synonyms: CLOST_2292Ferredoxin. Accession Number: P80168. Expression Region: 2~56aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 13.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292) is a purified Recombinant Protein.

Accession Number

P80168

Expression Region

2~56aa

Host

E. coli

Target

CLOST_2292

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CLOST_2292Ferredoxin

Species

Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIMB 10654) (Clostridium sticklandii)

Protein Name

Recombinant Protein

AA Sequence

AYVINDSCISCGACEPECPVNAITAGDDKYVIDAATCIDCGACAGVCPVDAPQPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)
MBS1375553-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)
MBS1375553-02 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)
MBS1375553-03 0.02 mg (Yeast)

Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)
MBS1375553-04 0.1 mg (Yeast)

Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)
MBS1375553-05 0.02 mg (Baculovirus)

Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)
MBS1375553-06 0.02 mg (Mammalian-Cell)

Recombinant Prochlorococcus marinus Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details