Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292)

Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIMB 10654) (Clostridium sticklandii) . Target Name: CLOST_2292. Target Synonyms: CLOST_2292Ferredoxin. Accession Number: P80168. Expression Region: 2~56aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 13.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Acetoanaerobium sticklandii Ferredoxin (CLOST_2292) is a purified Recombinant Protein.

Accession Number

P80168

Expression Region

2~56aa

Host

E. coli

Target

CLOST_2292

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CLOST_2292Ferredoxin

Species

Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIMB 10654) (Clostridium sticklandii)

Protein Name

Recombinant Protein

AA Sequence

AYVINDSCISCGACEPECPVNAITAGDDKYVIDAATCIDCGACAGVCPVDAPQPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhdc8b sgRNA CRISPR Lentivector set (Rat)
K7232401 3x 1.0 µg

Klhdc8b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Beta Galactosidase
553360-01 100 µg

Beta Galactosidase

Sign In for Pricing
View Details
Beta Galactosidase
553360-02 1 mg

Beta Galactosidase

Sign In for Pricing
View Details
C16orf13 (METTL26) (NM_032366) Human Tagged ORF Clone Lentiviral Particle
RC218337L3V 200 µL

C16orf13 (METTL26) (NM_032366) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Nuclear Factor I/C (NFIC, CCAAT-binding Transcription Factor, CTF, Nuclear Factor 1 C-Type, CTF5, MGC20153, NF-I, NF1-C, CTF, TGGCA-Binding Protein, NFI) (APC)
130611-APC 100 µL

Nuclear Factor I/C (NFIC, CCAAT-binding Transcription Factor, CTF, Nuclear Factor 1 C-Type, CTF5, MGC20153, NF-I, NF1-C, CTF, TGGCA-Binding Protein, NFI) (APC)

Sign In for Pricing
View Details
MGST1 Polyclonal Antibody
UB-GEN-3869 100 µL

MGST1 Polyclonal Antibody

Sign In for Pricing
View Details