Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Protein archease (PH1536)

Recombinant Pyrococcus horikoshii Protein archease (PH1536) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) . Target Name: PH1536. Accession Number: O59205. Expression Region: 1~142aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Pyrococcus horikoshii Protein archease (PH1536) is a purified Recombinant Protein.

Accession Number

O59205

Expression Region

1~142aa

Host

E. coli

Target

PH1536

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Protein Name

Recombinant Protein

AA Sequence

MKKWEHYEHTADIGIRGYGDSLEEAFEAVAIALFDVMVNVNKVEKKEVREIEVEAEDLEALLYSFLEELLVIHDIEGLVFRDFEVKIERVNGKYRLRAKAYGEKLDLKKHEPKEEVKAITYHDMKIERLPNGKWMAQLVPDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp456 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50984114 3x 1.0 µg

Zfp456 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Canine Chromodomain Y like protein (CDYL) ELISA kit
GTR10387422 96 Well

Canine Chromodomain Y like protein (CDYL) ELISA kit

Sign In for Pricing
View Details
Anti-FUBP3 Antibody
MBS8325107-01 0.03 mL

Anti-FUBP3 Antibody

Sign In for Pricing
View Details
Anti-FUBP3 Antibody
MBS8325107-02 0.05 mL

Anti-FUBP3 Antibody

Sign In for Pricing
View Details
Anti-FUBP3 Antibody
MBS8325107-03 0.1 mL

Anti-FUBP3 Antibody

Sign In for Pricing
View Details
Anti-FUBP3 Antibody
MBS8325107-04 0.2 mL

Anti-FUBP3 Antibody

Sign In for Pricing
View Details