Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial

Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: SF3B3. Target Synonyms: Splicing factor 3B subunit 3 (Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; Spliceosome-associated protein 130; SAP 130) . Accession Number: A0JN52. Expression Region: 860~1186aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial is a purified Recombinant Protein.

Accession Number

A0JN52

Expression Region

860~1186aa

Host

E. coli

Target

SF3B3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Splicing factor 3B subunit 3 (Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; Spliceosome-associated protein 130; SAP 130)

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

GQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase D (CPD) Human qPCR Template Standard (NM_001304)
HK202168 1 Kit

Carboxypeptidase D (CPD) Human qPCR Template Standard (NM_001304)

Sign In for Pricing
View Details
Mouse Transmembrane glycoprotein NMB (GPNMB) Elisa Kit
EK730943 96 Well

Mouse Transmembrane glycoprotein NMB (GPNMB) Elisa Kit

Sign In for Pricing
View Details
MIP Protein Vector (Mouse) (pPM-C-HA)
PV200948 500 ng

MIP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal TIGAR/C12orf5 Antibody (M2-P4H2) [mFluor Violet 450 SE]
NB100-2698MFV450 0.1 mL

Mouse Monoclonal TIGAR/C12orf5 Antibody (M2-P4H2) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Porcine Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit
MBS9362861-01 48 Well

Porcine Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit

Sign In for Pricing
View Details
Porcine Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit
MBS9362861-02 96 Well

Porcine Transcriptional Intermediary Factor 1 Beta (TIF1B) ELISA Kit

Sign In for Pricing
View Details