Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial

Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus) . Target Name: SF3B3. Target Synonyms: Splicing factor 3B subunit 3 (Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; Spliceosome-associated protein 130; SAP 130) . Accession Number: A0JN52. Expression Region: 860~1186aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial is a purified Recombinant Protein.

Accession Number

A0JN52

Expression Region

860~1186aa

Host

E. coli

Target

SF3B3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Splicing factor 3B subunit 3 (Pre-mRNA-splicing factor SF3b 130 kDa subunit; SF3b130; Spliceosome-associated protein 130; SAP 130)

Species

Bovine (Bos taurus)

Protein Name

Recombinant Protein

AA Sequence

GQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CES7 Antibody - middle region
OAAB05746-400UL 400 µL

CES7 Antibody - middle region

Sign In for Pricing
View Details
CCR8 Rabbit Monoclonal Antibody
E56G0626 100 µL

CCR8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BVDV Erns Recombinant Protein (C-His)
VK778041-01 50 µg

BVDV Erns Recombinant Protein (C-His)

Sign In for Pricing
View Details
BVDV Erns Recombinant Protein (C-His)
VK778041-02 100 µg

BVDV Erns Recombinant Protein (C-His)

Sign In for Pricing
View Details
BVDV Erns Recombinant Protein (C-His)
VK778041-03 1 mg

BVDV Erns Recombinant Protein (C-His)

Sign In for Pricing
View Details
ATR Rabbit mAb
F0773-100ul 100 µL

ATR Rabbit mAb

Sign In for Pricing
View Details