Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-oxoprolinase (OPLAH), partial

Recombinant Human 5-oxoprolinase (OPLAH), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: OPLAH. Target Synonyms: 5-oxo-L-prolinase; 5-OPase; Pyroglutamase. Accession Number: O14841. Expression Region: 209~302aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 17.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human 5-oxoprolinase (OPLAH), partial is a purified Recombinant Protein.

Accession Number

O14841

Expression Region

209~302aa

Host

E. coli

Target

OPLAH

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Metabolism

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

5-oxo-L-prolinase; 5-OPase; Pyroglutamase

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RELGFTHVSLSSEAMPMVRIVPRGHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPAGGVVGYSATTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKCDBP Immunizing Peptide
MBS425430-01 0.1 mg

PRKCDBP Immunizing Peptide

Sign In for Pricing
View Details
PRKCDBP Immunizing Peptide
MBS425430-02 5x 0.1 mg

PRKCDBP Immunizing Peptide

Sign In for Pricing
View Details
RGD1564053 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6331507 1.0 µg DNA

RGD1564053 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Tissue, Membrane Protein, Human Tumor Cell Line, MCF 7 (Human Breast Adenocarcinima)
MBS639777-01 0.1 mg

Tissue, Membrane Protein, Human Tumor Cell Line, MCF 7 (Human Breast Adenocarcinima)

Sign In for Pricing
View Details
Tissue, Membrane Protein, Human Tumor Cell Line, MCF 7 (Human Breast Adenocarcinima)
MBS639777-02 5x 0.1 mg

Tissue, Membrane Protein, Human Tumor Cell Line, MCF 7 (Human Breast Adenocarcinima)

Sign In for Pricing
View Details
Canine Anti-Double Stranded DNA Anti-body (Anti-dsDNA) ELISA KIT
NSL1770Ca 96 Tests

Canine Anti-Double Stranded DNA Anti-body (Anti-dsDNA) ELISA KIT

Sign In for Pricing
View Details