Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3)

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LYPD3. Target Synonyms: GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein; MIG-C4) . Accession Number: O95274. Expression Region: 31~326aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 37.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) is a purified Recombinant Protein.

Accession Number

O95274

Expression Region

31~326aa

Host

E. coli

Target

LYPD3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein; MIG-C4)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep cluster of differentiation 45 (CD45) ELISA kit
GTR10453472 96 Well

Sheep cluster of differentiation 45 (CD45) ELISA kit

Sign In for Pricing
View Details
Human Ephrin B1 ELISA KIT
EF009414 96 Tests

Human Ephrin B1 ELISA KIT

Sign In for Pricing
View Details
RANK Polyclonal Antibody, Cy5.5 Conjugated
bs-42227R-Cy5.5 100 µL

RANK Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Lasiodora sp. U2-theraphotoxin-Lsp1a
MBS1151726-01 0.02 mg (E-Coli)

Recombinant Lasiodora sp. U2-theraphotoxin-Lsp1a

Sign In for Pricing
View Details
Recombinant Lasiodora sp. U2-theraphotoxin-Lsp1a
MBS1151726-02 0.1 mg (E-Coli)

Recombinant Lasiodora sp. U2-theraphotoxin-Lsp1a

Sign In for Pricing
View Details
Recombinant Lasiodora sp. U2-theraphotoxin-Lsp1a
MBS1151726-03 0.02 mg (Yeast)

Recombinant Lasiodora sp. U2-theraphotoxin-Lsp1a

Sign In for Pricing
View Details