Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3)

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LYPD3. Target Synonyms: GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein; MIG-C4) . Accession Number: O95274. Expression Region: 31~326aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 37.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) is a purified Recombinant Protein.

Accession Number

O95274

Expression Region

31~326aa

Host

E. coli

Target

LYPD3

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

GPI-anchored metastasis-associated protein C4.4A homolog (Matrigel-induced gene C4 protein; MIG-C4)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dpt Pre-designed siRNA Set B
SI103881B 1 Each

Mouse Dpt Pre-designed siRNA Set B

Sign In for Pricing
View Details
PE Anti-Human HLA-DR Antibody[L243]
E-AB-F1111D-01 20 Tests

PE Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
PE Anti-Human HLA-DR Antibody[L243]
E-AB-F1111D-02 100 Tests

PE Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
PE Anti-Human HLA-DR Antibody[L243]
E-AB-F1111D-03 2x 100 Tests

PE Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
Vented Round Snap-Lock Containers
VRSL-250 250 Each

Vented Round Snap-Lock Containers

Sign In for Pricing
View Details
SURF1 Antibody
MBS8587475-01 0.1 mg

SURF1 Antibody

Sign In for Pricing
View Details