Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Left-right determination factor 2 (Lefty2)

Recombinant Mouse Left-right determination factor 2 (Lefty2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Lefty2. Target Synonyms: Left-right determination factor B (Protein lefty-2; Protein lefty-B; Leftb) . Accession Number: P57785. Expression Region: 78~368aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 40.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Left-right determination factor 2 (Lefty2) is a purified Recombinant Protein.

Accession Number

P57785

Expression Region

78~368aa

Host

E. coli

Target

Lefty2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Left-right determination factor B (Protein lefty-2; Protein lefty-B; Leftb)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

FSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OBFC2B, CT (NABP2, OBFC2B, SSB1, SOSS complex subunit B1, Nucleic acid-binding protein 2, Oligonucleotide/oligosaccharide-binding fold-containing protein 2B, Sensor of single-strand DNA complex subunit B1, Sensor of ssDNA subunit B1, Single-stranded DNA-binding protein 1) (MaxLight 405) discontinued
039247-ML405 100 µL

OBFC2B, CT (NABP2, OBFC2B, SSB1, SOSS complex subunit B1, Nucleic acid-binding protein 2, Oligonucleotide/oligosaccharide-binding fold-containing protein 2B, Sensor of single-strand DNA complex subunit B1, Sensor of ssDNA subunit B1, Single-stranded DNA-binding protein 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
BFA
ABC-TC0075 1 Vial

BFA

Sign In for Pricing
View Details
Lambda 5 (A-1) Alexa Fluor® 647
sc-398932 AF647 200 µg/mL

Lambda 5 (A-1) Alexa Fluor® 647

Sign In for Pricing
View Details
Macrophage Stimulating Protein (MSP) Antibody
abx103051-01 100 µL

Macrophage Stimulating Protein (MSP) Antibody

Sign In for Pricing
View Details
Macrophage Stimulating Protein (MSP) Antibody
abx103051-02 200 µL

Macrophage Stimulating Protein (MSP) Antibody

Sign In for Pricing
View Details
Macrophage Stimulating Protein (MSP) Antibody
abx103051-03 1 mL

Macrophage Stimulating Protein (MSP) Antibody

Sign In for Pricing
View Details