Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Left-right determination factor 2 (Lefty2)

Recombinant Mouse Left-right determination factor 2 (Lefty2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Lefty2. Target Synonyms: Left-right determination factor B (Protein lefty-2; Protein lefty-B; Leftb) . Accession Number: P57785. Expression Region: 78~368aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 40.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Left-right determination factor 2 (Lefty2) is a purified Recombinant Protein.

Accession Number

P57785

Expression Region

78~368aa

Host

E. coli

Target

Lefty2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Left-right determination factor B (Protein lefty-2; Protein lefty-B; Leftb)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

FSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Zinc finger and BTB domain containing protein 17 (ZBTB17) ELISA kit
GTR10398597 96 Well

Canine Zinc finger and BTB domain containing protein 17 (ZBTB17) ELISA kit

Sign In for Pricing
View Details
Rabbit Polyclonal CHIC1 Antibody
NBP2-58153 100 µL

Rabbit Polyclonal CHIC1 Antibody

Sign In for Pricing
View Details
Prkn (NM_020093) Rat Untagged Clone
RN212553 10 µg

Prkn (NM_020093) Rat Untagged Clone

Sign In for Pricing
View Details
Zkscan17 Protein Lysate (Mouse) with C-HA Tag
51260035 100 µg

Zkscan17 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Human RCN1 Protein
E30P1421 20 µg

Recombinant Human RCN1 Protein

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis UPF0307 protein ETA_29350 (ETA_29350)
MBS1087017-01 0.02 mg (E-Coli)

Recombinant Erwinia tasmaniensis UPF0307 protein ETA_29350 (ETA_29350)

Sign In for Pricing
View Details