Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integrin beta-like protein 1 (ITGBL1)

Recombinant Human Integrin beta-like protein 1 (ITGBL1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ITGBL1. Target Synonyms: Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein. Accession Number: O95965. Expression Region: 24~494aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 58.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Integrin beta-like protein 1 (ITGBL1) is a purified Recombinant Protein.

Accession Number

O95965

Expression Region

24~494aa

Host

E. coli

Target

ITGBL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

58.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IAH1 ORF Vector (Human) (pORF)
24126011 1.0 µg DNA

IAH1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Collagen 5 alpha 1 Antibody
MBS8584099-01 0.1 mL

Collagen 5 alpha 1 Antibody

Sign In for Pricing
View Details
Collagen 5 alpha 1 Antibody
MBS8584099-02 0.1 mL (AF635)

Collagen 5 alpha 1 Antibody

Sign In for Pricing
View Details
Collagen 5 alpha 1 Antibody
MBS8584099-03 0.1 mL (AF610)

Collagen 5 alpha 1 Antibody

Sign In for Pricing
View Details
Collagen 5 alpha 1 Antibody
MBS8584099-04 0.1 mL (AF405S)

Collagen 5 alpha 1 Antibody

Sign In for Pricing
View Details
Collagen 5 alpha 1 Antibody
MBS8584099-05 0.1 mL (AF405L)

Collagen 5 alpha 1 Antibody

Sign In for Pricing
View Details