Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integrin beta-like protein 1 (ITGBL1)

Recombinant Human Integrin beta-like protein 1 (ITGBL1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ITGBL1. Target Synonyms: Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein. Accession Number: O95965. Expression Region: 24~494aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 58.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Integrin beta-like protein 1 (ITGBL1) is a purified Recombinant Protein.

Accession Number

O95965

Expression Region

24~494aa

Host

E. coli

Target

ITGBL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

58.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound NP-018899
T129222-01 10 mg

Compound NP-018899

Sign In for Pricing
View Details
Compound NP-018899
T129222-02 1 g

Compound NP-018899

Sign In for Pricing
View Details
Compound NP-018899
T129222-03 1 mg

Compound NP-018899

Sign In for Pricing
View Details
Compound NP-018899
T129222-04 50 mg

Compound NP-018899

Sign In for Pricing
View Details
Compound NP-018899
T129222-05 5 mg

Compound NP-018899

Sign In for Pricing
View Details
Rabbit Polyclonal ACCN1 Antibody [Janelia Fluor 646]
NB100-2531JF646 0.1 mL

Rabbit Polyclonal ACCN1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details