Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Heparanase (Hpse), partial

Recombinant Rat Heparanase (Hpse), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Hpse. Target Synonyms: Endo-glucoronidase (Hep) . Accession Number: Q71RP1. Expression Region: 29~102aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Heparanase (Hpse), partial is a purified Recombinant Protein.

Accession Number

Q71RP1

Expression Region

29~102aa

Host

E. coli

Target

Hpse

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Endo-glucoronidase (Hep)

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[1- (Oxan-4-yl) azetidin-2-yl]methanamine
CFD80191-01 50 mg

[1- (Oxan-4-yl) azetidin-2-yl]methanamine

Sign In for Pricing
View Details
[1- (Oxan-4-yl) azetidin-2-yl]methanamine
CFD80191-02 0.5 g

[1- (Oxan-4-yl) azetidin-2-yl]methanamine

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit DIY Materials
MBS2088722-01 5x 96 Tests

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit DIY Materials
MBS2088722-02 5x 96 Tests + MBS2089472 (Support Pack 2,5x 96 Tests)

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit DIY Materials
MBS2088722-03 10x 96 Tests

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit DIY Materials

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit DIY Materials
MBS2088722-04 10x 96 Tests + MBS2089472 (Support Pack 2, 10x 96 Tests)

Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit DIY Materials

Sign In for Pricing
View Details