Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FGF2. Target Synonyms: Basic fibroblast growth factor; bFGFHeparin-binding growth factor 2; HBGF-2. Accession Number: P09038. Expression Region: 143~288aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 64.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated is a purified Recombinant Protein.

Accession Number

P09038

Expression Region

143~288aa

Host

E. coli

Target

FGF2

Conjugation

Unconjugated

Tag

N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Basic fibroblast growth factor; bFGFHeparin-binding growth factor 2; HBGF-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamic Acid Decarboxylase (GAD)
G7116-05 100 µg

Glutamic Acid Decarboxylase (GAD)

Sign In for Pricing
View Details
Boc-3- (2-quinoxalyl) -DL-Ala-OH
sc-300267 500 mg

Boc-3- (2-quinoxalyl) -DL-Ala-OH

Sign In for Pricing
View Details
Hamster Caenorhabditis Elegans Death Gene ELISA Kit
MBS041274-01 48 Well

Hamster Caenorhabditis Elegans Death Gene ELISA Kit

Sign In for Pricing
View Details
Hamster Caenorhabditis Elegans Death Gene ELISA Kit
MBS041274-02 96 Well

Hamster Caenorhabditis Elegans Death Gene ELISA Kit

Sign In for Pricing
View Details
Hamster Caenorhabditis Elegans Death Gene ELISA Kit
MBS041274-03 5x 96 Well

Hamster Caenorhabditis Elegans Death Gene ELISA Kit

Sign In for Pricing
View Details
Hamster Caenorhabditis Elegans Death Gene ELISA Kit
MBS041274-04 10x 96 Well

Hamster Caenorhabditis Elegans Death Gene ELISA Kit

Sign In for Pricing
View Details