Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FGF2. Target Synonyms: Basic fibroblast growth factor; bFGFHeparin-binding growth factor 2; HBGF-2. Accession Number: P09038. Expression Region: 143~288aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 64.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated is a purified Recombinant Protein.

Accession Number

P09038

Expression Region

143~288aa

Host

E. coli

Target

FGF2

Conjugation

Unconjugated

Tag

N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Basic fibroblast growth factor; bFGFHeparin-binding growth factor 2; HBGF-2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sstr2 shRNA (UAS) - Lentiviral mouse Sstr2 shRNA (UAS, GFP) plasmid
GTR15181678 1 Vial

Lentiviral mouse Sstr2 shRNA (UAS) - Lentiviral mouse Sstr2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RPL8P3 AAV Vector (Human) (CMV)
41927101 1 µg

RPL8P3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human GGA2 Knockout A549 cell line
GTR15418915 1 Vial

Human GGA2 Knockout A549 cell line

Sign In for Pricing
View Details
1- (4-Fluorophenyl) -4,6-dioxo-1,4,5,6-tetrahydropyridazine-3-carboxylic acid
DXC60092-01 100 mg

1- (4-Fluorophenyl) -4,6-dioxo-1,4,5,6-tetrahydropyridazine-3-carboxylic acid

Sign In for Pricing
View Details
1- (4-Fluorophenyl) -4,6-dioxo-1,4,5,6-tetrahydropyridazine-3-carboxylic acid
DXC60092-02 1 g

1- (4-Fluorophenyl) -4,6-dioxo-1,4,5,6-tetrahydropyridazine-3-carboxylic acid

Sign In for Pricing
View Details
Rat CXCR2 Allophycocyanin MAb (Clone 866614)
FAB8110A 100 Tests

Rat CXCR2 Allophycocyanin MAb (Clone 866614)

Sign In for Pricing
View Details